PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0186s0053.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 463aa    MW: 52434.6 Da    PI: 7.29
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0186s0053.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.83.9e-1326991597
                         -EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3 15 rlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                         ++ +p +f+ ++ +g+   +    l++ ++ r W v++   +++    + +GW+eFv++n+L +g+++vF++dg ++f   v+vf
  Kalax.0186s0053.1.p 26 NFLIPADFC-KYlEGER--GEAAELRSrRRRRPWPVRI--VGRR----IVDGWEEFVRENELHVGEILVFRYDGGMCF--DVTVF 99
                         389******.5547774..4568888846679******..7777....889**********************99999..77766 PP

2B340.35.6e-131562371497
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          + l +p +f+ ++++kk++s  ++++de+g+sW vkl ++k +++++ ++GW +F k+ g++eg+ +  ++++ +++++v++++
  Kalax.0186s0053.1.p 156 RSLFFPVPFILDNQLKKARS-GIVVRDEKGKSWPVKLGFKKWGNAVYTRDGWYSFIKETGIREGEDFEVQVIS-QGRKPVLTFR 237
                          33789**********99998.9******************************************998888776.5666666665 PP

3B344.43.1e-14360441989
                          HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                           + +++rlv+  +fa++++++++++  ++l++++g+ W  +l+y  +k++++y++++GWkeF+ +ngL +g  + ++ ++ ++
  Kalax.0186s0053.1.p 360 PMIERSRLVVGVEFARANDLINKCG-SIILKNQKGEPWAATLKYtkKKTQDSYYISAGWKEFALSNGLGVGCQFKLEIEQPES 441
                          567899************9998777.9*****************64555555*******************777777555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.5E-1711104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.75E-1712109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.92812102IPR003340B3 DNA binding domain
CDDcd100171.98E-111399No hitNo description
SMARTSM010193.1E-1215102IPR003340B3 DNA binding domain
PfamPF023625.8E-102697IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.2E-11143238IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.292143239IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-13145242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.16E-9145250No hitNo description
SMARTSM010193.5E-7146240IPR003340B3 DNA binding domain
PfamPF023624.6E-11156238IPR003340B3 DNA binding domain
PROSITE profilePS5086311.096352450IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-12352439IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.2E-5353450IPR003340B3 DNA binding domain
PfamPF023622.2E-12358447IPR003340B3 DNA binding domain
SuperFamilySSF1019361.8E-12362437IPR015300DNA-binding pseudobarrel domain
CDDcd100171.42E-16364458No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MADEERSQFP TGPHFLQPVT TDLATNFLIP ADFCKYLEGE RGEAAELRSR RRRRPWPVRI  60
VGRRIVDGWE EFVRENELHV GEILVFRYDG GMCFDVTVFG PTACEKEFPP LATSPAAADE  120
NLELEETAAI RGDRLNCPPQ AGTDSYVGTM KPSYLRSLFF PVPFILDNQL KKARSGIVVR  180
DEKGKSWPVK LGFKKWGNAV YTRDGWYSFI KETGIREGED FEVQVISQGR KPVLTFRRIC  240
NEENSRVSEF ENRQKADQVS EPKIEPITRQ MADQAPEPET DPMPKPAKRQ EAEEVRVPET  300
EWVATPAKKQ KTIEVPVPET EWVATSAKKH KVQGHTLTEQ KTDSPRAVRC TYFYATSTWP  360
MIERSRLVVG VEFARANDLI NKCGSIILKN QKGEPWAATL KYTKKKTQDS YYISAGWKEF  420
ALSNGLGVGC QFKLEIEQPE SDILTFKLSE CLPGKLRVGD SA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-30B3 family protein